PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00025.1_g00052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 259aa    MW: 29399 Da    PI: 8.6534
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00025.1_g00052.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.81e-072873346
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                              WT+eE + + +a + ++ +   +W  Ia++++ g+t  ++   + k
  Rsa1.0_00025.1_g00052.1 28 VWTKEENKMFERALAIYPEDspdRWFNIASMIP-GKTVFDVMKQYSK 73
                             7********************************.***9999888876 PP

2Myb_DNA-binding38.13.6e-12124168347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
  Rsa1.0_00025.1_g00052.1 124 PWTDEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKY 168
                              7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.2262477IPR017884SANT domain
SMARTSM007176.8E-92577IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-42673IPR009057Homeodomain-like
SuperFamilySSF466896.01E-122781IPR009057Homeodomain-like
PfamPF002491.7E-62873IPR001005SANT/Myb domain
CDDcd001673.96E-82974No hitNo description
PROSITE profilePS5129417.547117173IPR017930Myb domain
SuperFamilySSF466891.5E-15119172IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-17120172IPR006447Myb domain, plants
SMARTSM007177.1E-9121171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-10122168IPR009057Homeodomain-like
CDDcd001671.27E-8124168No hitNo description
PfamPF002492.7E-9124168IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
METLHPLSHV PISDHRLVVQ EMMSSSSVWT KEENKMFERA LAIYPEDSPD RWFNIASMIP  60
GKTVFDVMKQ YSKLEEDVSD IEAGRVPVPG YPSASSPLGF DQDTCRKRPS WGRGSDHDRK  120
KGIPWTDEEH RRFLLGLLKY GKGDWRNISR NFVVSKTPTQ VASHAQKYYL RQLSGAKDKR  180
RPSIHDTTTV NLLNANRNRS FSDHRDILPD LGFVDKDNAE DGLMSMSPNR YSANLFSPSS  240
SPFDDAICFA GANAFRARS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-18291061188RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013647448.11e-174PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-74DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078HEX61e-178A0A078HEX6_BRANA; BnaA01g30920D protein
STRINGBra034173.1-P1e-172(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-158MYB family protein